Human Calprotectin(S100A9), His tag
SKU: 90234894120

Human Calprotectin(S100A9), His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Calprotectin(S100A9), His tagProduct Specification Species Human Synonyms Calgranulin B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor related protein 14; S100 calcium binding protein A9; CAGB, CFAG, MRP14 Accession P06702 Amino Acid Sequence Protein sequence(P06702, Met1 Pro114, with C 10*His) MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; S100 calcium-binding protein A9; CAGB, CFAG, MRP14
Accession P06702
Amino Acid Sequence

Protein sequence(P06702, Met1-Pro114, with C-10*His)
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:14.9kDa Actual:15.0kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

S100A9 is a member of the S100 family of proteins containing 2 EF hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase. Intracellular S100A9 alters mitochondrial homeostasis within neutrophils. As a result, neutrophils lacking S100A9 produce higher levels of mitochondrial superoxide and undergo elevated levels of suicidal NETosis in response to bacterial pathogens. Furthermore, S100A9-deficient mice are protected from systemic Staphylococcus aureus infections with lower bacterial burdens in the heart, which suggests an organ-specific function for S100A9.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90234894120

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 663 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tom Fulery
San Leandro, US
★★★★★ 5
Wow, a great surprise dark comedy from the 1970s!
A real treat from Michael Ritchie (The Golden Child) with an excellent script, an A+ cast and plenty of action, despite the fact that it's really a very dark – almost surreal – comedy/satire about the meat industry in the 'American Heartland.' As usual, Lee Marvin, Gene Hackman and Sissy Spacek bring their best work. very graphic cinematography, real physical special effects (no CGI) and good plot twists make it a riveting experience. Highly recommended for those who like their dark satires well-done!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2024
D
Verified Purchase
Donna Erno
Charlottesville, US
★★★★★ 5
Lots of Action in this 70s Movie
I bought this movie for my husband and he really liked this 70s movie.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
L
Verified Purchase
ltwillman
Chelsea, US
★★★★★ 5
Not well known, but should be!
Two of my favorite male actors of all time creating an interesting movie, this one has it all!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
W
Verified Purchase
Wayne Klein
San Leandro, US
★★★★★ 4
Minor classic that pits Lee Marvin and Gene Hackman in thriller.
A terrific neo noir with touches of Hitchcock, “Prime Cut” revels in the cliches of many of the genres- the criminal with the heart of gold and the sleazy underworld of the bad guys. Spoilers: Set in the Heartland, the film. Follows Nick (Lee Marvin) an enforcer hired by the Irish Mob who is send to collect from Mary Ann (Gene Hackman-really!) the owner of a meat packing planet who has a prostitution racket on the side for young and underage girls. Mary Ann had been stiffing the Mob on a debt and each enforcer has been killed and sent back in an interesting way. Nick is horrified at the prostitution ring that Mary Ann runs; they have history as well and that history plays into the animosity of both men as they fight it out Ina thrilling conclusion. Towards the end of his career as an enforcer, Nick disliked the way his world has turned out. Michael Richtie was at the beginning of his career as a director but was clearly in control as a director staging some thrilling scenes with echoes of Hitchcock’s classics “North by Northwest” and other classics. Richtie doesn’t ape Hitch so much as may the sequences work in the context of his film. The 4 K and Blu-ray look terrific from a fresh transfer of the original camera negative. There’s virtually no issues with the films. Colors are strong, detail excellent and it looks of its time without any messing about with the image. The mono audio pushes dialogue up front but there is a nice, robust feel to the rest of the mono soundtrack. The film has two commentary tracks both very good (one has to use the audio selection to hear them as I didn’t see it in the main menu for the 4K). We find out, for example, that Hackman took his second billed role because he had just finished “The French Connection” and hadn’t worked for six months. Richtie and Marvin butted heads because Richtie wanted Marvin to do a love scene with the much younger Sissy Spacek in her debut. Marvin felt uncomfortable with that because of their age difference (she was 23 and Marvin was 49). A Blu-ray (that was previously released a couple of years back) is also included. Kino has done a fine job of brining this minor classic to 4K and Blu-ray. One may feel like they need to take a shower after watching the film because of how sleazy Hackman plays an already nasty character like Mary Ann. Putting this in the heartland with all the corruption of the big city adds an element that is missing from many films like this. The corruption at heart of Mary Ann and the community he has tainted by his presence points to the rot that was growing in America at the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 21, 2024
F
Verified Purchase
6ftalicecooper
Birmingham, US
★★★★★ 5
RIP Gene Hackman…Holy $?#! This movie!
Prime Cut is honestly more a 3 1/2 star movie however KINO gets 5 stars for releasing a beautiful transfer of this mean & nasty 70s crime drama that’s as violent as it is weird. Hackman as the Kansas City Gangster who makes enemies into hotdogs before sending them back, draws the ire of Chicago enforcer Marvin to collect a large sum of money from Mary Ann - Hackman’s name by the way. The Blu Ray doesn’t have much but if you like sleazy, mean, & odd 70s crime thrillers, take a hefty bite of this PRIME CUT.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 6, 2025

recommand products