Human PGA4(PGI), His tag
SKU: 78812345704

Human PGA4(PGI), His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PGA4(PGI), His tagProduct Specification Species Human Synonyms Pepsin A 4, Pepsinogen 4 Accession P0DJD7 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH Expression System HEK293

Product Specification


Species Human
Synonyms Pepsin A-4, Pepsinogen-4
Accession P0DJD7
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:41.9kDa Actual:45kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Pepsin is an endopeptidase that breaks down proteins into smaller peptides. It is produced in the gastric chief cells of the stomach lining and is one of the main digestive enzymes in the digestive systems of humans and many other animals, where it helps digest the proteins in food. Pepsin is an aspartic protease, using a catalytic aspartate in its active site. Pepsin's proenzyme, pepsinogen, is released by the gastric chief cells in the stomach wall, and upon mixing with the hydrochloric acid of the gastric juice, pepsinogen activates to become pepsin. Pepsinogens are mainly grouped in 5 different groups based on their primary structure: pepsinogen A (also called pepsinogen I), pepsinogen B, progastricsin (also called pepsinogen II and pepsinogen C), prochymosin (also called prorennin) and pepsinogen F (also called pregnancy-associated glycoprotein).Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78812345704

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 305 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jessica Hull
Omaha, US
★★★★★ 4
A sexy, frustrating sports romance that made me want to scream from the inside out!!
Format: Kindle
The Goal is an unpredictable, messy romance that follows a determined, headstrong, stoic law student and a sweet, laidback southern hockey player as they find their plans on thin ice, their goals suddenly beyond their reach. Sabrina and Tucker are two very different personalities headed in two very different directions. Sabrina has one goal... escape. The shame and the frustration of her broken, twisted home life has made her ruthless in her drive toward that escape, her academic goals providing her with the only way out. But that drive, that shame, that proud determination makes for a character that is so closed off, so hardened. She's the polar opposite of John Tucker, the sweet, loveable Texan who might be unsure of his immediate plans, but he knows where he ultimately wants to end up. Sabrina and Tucker thought they knew where they were headed, they each had their own plans for their respective futures, but when their lives tangle, the unexpected threatens everything. It's a dicey move to take an unlikable character from a previous book and turn her into your next heroine. It's hard to sell that to readers who've been trained to hate that character by the very same author now looking to endear them to her. Full disclosure, I'm a reader that didn't like Sabrina before either. We weren't meant to. So, of course, I was skeptical that I'd come to want a guy like John Tucker with a girl like her. But while she's definitely a tough nut to crack, I very much appreciated what this author chose to do with this character in The Goal. Sabrina isn't like other girls. She's as unapologetically sexual as the horny hockey players in this series. She's as impenetrable and difficult and frustrating as NA male characters typically are.  She's complex and fierce and she has priorities that don't involve long term relationships. She doesn't exude a lot of vulnerability or emotion. She can come across as selfish, but it's not in a malicious way. She's just a girl that has always had to look out for herself and put herself first because no one else ever has. And given all of that, I'd say Elle Kennedy has successfully turned a villain into a heroine, and she's done so without compromising the integrity of her character. I can't get on board with an author taking a character she once vilified and completely altering her personality to fit the new goal of the author, to make her the sweetheart heroine you wish your readers will suddenly fall in love with. I have much more respect and appreciation for Elle Kennedy's choice to ensure Sabrina is still Sabrina. And getting to know her in all of her flaws and rough edges and her maddening stubbornness, I can NOW allow myself to want good things for her despite being so frustrated with her, without feeling like I read a story about a completely different character than the one presented to me previously. This author gets an A for character consistency. A big fat A. I really enjoyed this installment. It hasn't topped The Score for me as a series favorite, but it's a really beautiful, angsty story about finding new dreams, discovering all the things you want in life even if they were never part of your original plan. It's about deciding what's most important. It's about making the choice to roll with whatever life throws at you as long as the right person is there to hold your hand through it all. Sabrina is a hard heroine to root for. And Tucker is so freakishly nice, he's the polar opposite of the bad boys I typically fall for. But there was something so right about this couple. Even when everything was stacked against them, even when Sabrina fought so hard against the good in her life, even when Tucker should have probably run the other way, I wanted good things for this couple. I wanted their happily ever after. And Elle Kennedy delivers a really solid storyline that took me and these characters exactly where I'd hoped we'd go by way of the road less traveled. The Goal made me feel all the things. As Kennedy's sports romances tend to do, The Goal is chock full of colorful characters whose banter had me laughing and sighing, swooning and smiling. This story is peppered with amusing moments, times of heartbreak,  seriously steamy, sexy scenes and the most frustratingly maddening storyline of the series. And I really loved it. I love a story that makes me want to scream from the inside out. There's a lot of ways a writer can drive a reader to the brink and this story tested my patience and my tolerance in ways no other book has before. Sabrina takes stubborn to a whole other place and Tucker's patience with her was far more virtuous than mine. But as stressful and angst ridden and damn infuriating as I found their story, it's a deliciously satisfying, honest one and I really, really enjoyed it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2016
M
Verified Purchase
Mrs. Julien
Massapequa, US
★★★★★ 3
Good, But Not Great
Format: Kindle
3.5 stars In the fourth, but hopefully not final, book in Elle Kennedy’s enjoyable Off Campus contemporary new adult romance series, another university student hockey player and lovely young woman find a future in each other as they move inexorably towards adult lives. Sabrina James has been surviving on ambition, overwork, and very little sleep as she drives herself through her final undergrad year. Determined to make a better life for herself and gain distance from her grinding family life, she is going to go to law school if it kills her. Her upbringing in an unpleasant, complicated family has made her self-reliant to the point of leeriness and incredibly driven. It’s been a long time since I wanted to see a heroine to escape as much as I wanted a better life for Sabrina. Show me a capable woman fighting dream crushers telling her who she is and you have my full attention. Letting off steam one evening, Sabrina meets John “Tuck” Tucker. He’s a charming member of the men’s hockey team at her university. While she likes athletes, she has sworn off hockey players after a bad experience with one. Tuck’s a temptingly engaging and unassuming guy though, so she makes an exception for him just for one night. Laid-back Tuck finds himself smitten with tough, but sweet Sabrina and he pursues her until – WONDER OF WONDERS AND MIRACLE OF MIRACLES – she tells him she’s not interested and he backs off. (Let’s pause to thank Elle Kennedy for a hero taking no for answer.) When Sabrina realises she’s pregnant, she finds herself seeking Tuck out and things move forward from there. Tuck is all in. It’s been three years since I asked this question, but I still don’t have the answer. Should a hero be a perfect guy or the perfect guy for the heroine? Is there a difference? Tuck is pretty amazing. He’s grounded, patient, an enthusiastic and attentive paramour, hard-working, calm, rational, responsible, patient again plus synonyms for it, mature, kind, sensible, fun, good-looking, protective in a non-overbearing way, bearded (to start off with and, admittedly, that may only make him perfect to me), supportive, and financially secure. Tuck gives Sabrina time and space, he participates as much or as little as she wants him to with her pregnancy and its ramifications, and bides his time while she comes around to the same conclusion he did the night they met. Tuck and Sabrina face almost insurmountable odds in succeeding with the stresses of their relationship, school, baby, and getting established in adult lives and all, I thought, with virtually no sacrifices. I guess that’s where the wish-fulfillment part of these books comes in. Young people having an instant family plot is not my favourite, but Kennedy did a good job with the story and she continues to be very good at writing friendships in addition to the love story. I will be buying all of the other books in the Off Campus series as they are published.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2017
K
Verified Purchase
Kindle Customer
Belleville, US
★★★★★ 5
🥺🤭🤍👏🏼
Format: Kindle
“My goal, once upon a time, was to succeed. I didn’t realize that success wasn’t grades or scholarships or achievements, but the people I was lucky enough to have in my life.” 👏🏼 I will say again I absolutely love this series. But Tucker’s southern drawl, patience, sweetness, and maturity level😍 this man is amazing! Seeing Sabrina character grow from unsure about love or trusting anyone. To falling for a guy that broke all those walls down for her. Ughhhh my heart!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
R
Verified Purchase
Rebekah
Pawtucket, US
★★★★★ 4
great book!
Format: Kindle
Great book! I loved the main male character. Storyline was pretty good. I would recommend it but don’t feel like it’s 5 stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
J
Verified Purchase
JennaStrick
Alexandria, US
★★★★★ 5
Great couple!
Format: Kindle
This is my second read of this story. And I loved it then, and I loved it now. Tucker is super sweet but also sexy steamy. Sabrina is independent and feisty. But I loved how they brought out the others non dominant sides. They had great chemistry and although it wanted to shake Sabrina at times lol, Tucker is totally patient and such a great book boyfriend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products